bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4473_orf1 Length=162 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000139891 104 1e-21 > 31033.SINFRUP00000139891 Length=753 Score = 104 bits (259), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 68/166 (40%), Positives = 97/166 (58%), Gaps = 15/166 (9%) Query 4 QLQQQQQQAAEAAAGTDTKTEVSPQEKLETAAPDLARIWLSDCPAVEPWD---LP-LLKQ 59 QL++ Q + ++AA KT + KL AP I + P VE WD LP + Sbjct 393 QLERLQNEISQAAK----KTGIHASTKLALIAPK-KEIEDGEIPNVEWWDSFILPSYINL 447 Query 60 TKTKAYEIDETKIDALIEHP----PPIATVAKGEAIVNMYLTPAERKKLRRRKRQERERE 115 +T E++ + L+EHP PP+ T + + +YLT E+KKLRR+ R+E ++E Sbjct 448 AETNFDEVELFGVTNLVEHPAQIRPPVDT--NKQVTLGVYLTKKEQKKLRRQTRREAQKE 505 Query 116 KPDKIRMGLLPPPPPKCKLSNLMRVLGDVAVADPSKTEKKVREQMA 161 +K+R+GL+PPP PK ++SNLMRVLG AV DP+K E VR QMA Sbjct 506 VQEKVRLGLMPPPEPKVRISNLMRVLGTEAVQDPTKVEAHVRAQMA 551 Lambda K H 0.312 0.128 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 27386790332 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40