bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4459_orf1 Length=207 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0218318 65.5 1e-09 > 44689.DDBDRAFT_0218318 Length=1339 Score = 65.5 bits (158), Expect = 1e-09, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 0/62 (0%) Query 3 ASLVPLGELLNHHYHGQVLSPAFEGDERSLCLRLACDVPAGAQVYAHYGPLQSWQFLAYF 62 + LVP+ +++NHH + Q+ F+ D +S + +C++PA Q++ HYG LQ+W+ Y+ Sbjct 941 SCLVPMADMINHHTNAQISERFFDHDSQSFKMISSCNIPANNQIFLHYGALQNWELALYY 1000 Query 63 GF 64 GF Sbjct 1001 GF 1002 Lambda K H 0.319 0.137 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52061985665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40