bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4403_orf1 Length=194 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.144 71.6 1e-11 > 5833.MAL13P1.144 Length=481 Score = 71.6 bits (174), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 46/181 (25%), Positives = 87/181 (48%), Gaps = 23/181 (12%) Query 11 NPVTVVVDDAGVQLLAIQDRHSMSHGSSLQIPKLHLFLYPSQHLLPHYYDPHVYVFTHAT 70 N V V +D ++++I+D SM ++I K++L + + L D HVY+F H Sbjct 187 NNVWVCIDKNS-KVVSIKDSLSMKENGKMKISKVNLLFHKNFVLKTDLLDSHVYIFKHYV 245 Query 71 LKIFDQPSLRHSLYSIRFDLVPYMTTMQMTSAAEVWSNSRLECDIFEQKLWAIQHQGEEE 130 L+I +Q + S SI++DL+PY+ +Q TS A +S + +++ + +++G++ Sbjct 246 LEIMEQKKNKFS--SIKYDLIPYLVKIQNTSKAAEYSKGEFKYNMYNTLIE--KYEGDD- 300 Query 131 STSTSQTATAPTNEMPTGSGLPVHYTAANPPPRPAKGNRVVCCIHPEAAGICCRVNNLAD 190 E+ G + N + VVC I P+ G C R+N++ + Sbjct 301 -------------EIEEGKRENLMLDIINNENVES----VVCYIQPKNNGFCQRINSIPN 343 Query 191 Y 191 + Sbjct 344 F 344 Lambda K H 0.318 0.131 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 44893337425 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40