bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4402_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 9615.ENSCAFP00000028861 240 7e-63 > 9615.ENSCAFP00000028861 Length=495 Score = 240 bits (613), Expect = 7e-63, Method: Compositional matrix adjust. Identities = 110/139 (79%), Positives = 121/139 (87%), Gaps = 0/139 (0%) Query 5 LDLGGASTQITFETTSPTEDPANEVQLRLYGQRYRVYTHSFLCYGRDQVLRRLLARALQT 64 +DLGGASTQITFE P EDP NEVQLRLYGQ YRVYTHSFLCYGRDQVL RLLA ALQT Sbjct 200 MDLGGASTQITFEMAGPAEDPTNEVQLRLYGQHYRVYTHSFLCYGRDQVLLRLLAGALQT 259 Query 65 HGSHPCWPRGYSTHVMLWDVYESPCTAAQRPQAFNRSTRVSLAGSSDPALCRSLVSQLFN 124 +G HPCWPRGYS+ V+L DVYESPCT AQRPQ F STRV+L+G+SDPALCR L+ +LFN Sbjct 260 YGFHPCWPRGYSSQVLLQDVYESPCTVAQRPQTFTGSTRVNLSGTSDPALCRGLILELFN 319 Query 125 SSSCHFSRCSFNGVFQPPV 143 SSCHFS+CSFNG+FQPPV Sbjct 320 FSSCHFSQCSFNGIFQPPV 338 Lambda K H 0.322 0.133 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40