bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4384_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000011905 66.6 2e-10 > 69293.ENSGACP00000011905 Length=414 Score = 66.6 bits (161), Expect = 2e-10, Method: Composition-based stats. Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (2%) Query 8 LNIVVFGSFLPHSILRHFRVFCSVLRMLYLVLTAIMTGHVGYDLVFNDQVAVVNPLLRL- 66 L +V G +LP S+ + C+ LRM+Y+ L + V YD+VF DQV+V P+LRL Sbjct 65 LPVVCVGDWLPTSVFGYLHALCAYLRMIYVALYLVFLSGVEYDVVFCDQVSVCIPVLRLS 124 Query 67 -VGKKVIFYGHFP 78 + KKV+FY HFP Sbjct 125 RLRKKVLFYCHFP 137 Lambda K H 0.336 0.149 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23019419813 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40