bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4101_orf1 Length=252 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0430w 256 4e-67 > 5833.PFE0430w Length=1490 Score = 256 bits (655), Expect = 4e-67, Method: Composition-based stats. Identities = 121/236 (51%), Positives = 167/236 (70%), Gaps = 8/236 (3%) Query 22 DRQTCLFSATFPSHIESLARRILYKPIEVVVGEKGRTAAKVQQYVEVMDEERKFYRLLQL 81 D+QT + SATFP++I+++A+++LYKPIE++VGEKG+T + Q+VE+++E +K +RLL+L Sbjct 904 DKQTAMISATFPNYIQNMAKKLLYKPIEIIVGEKGKTNNNIYQFVEIIEESKKVFRLLKL 963 Query 82 LGDWQDYGSIIIFVNKQIEADDLFAELLKYGYQALVLHGGQDQTDREFTIQEFKDGTKTL 141 LG+W YG ++IFVNKQIEAD L+ EL KY Y LVLHGGQDQTDR+FT+++FK + Sbjct 964 LGEWIKYGLVLIFVNKQIEADLLYLELYKYDYNLLVLHGGQDQTDRQFTLEKFKKEENKV 1023 Query 142 LIATSVAARGLDVPSVVLVINFCCPSHIEDYVHRIGRTGRAGNIGVAYTFITPQEADKAE 201 LIATSV ARG+D+ +++LVIN+ CP HIEDY+HRIGRTGR+ NIG AYTFI P E KA Sbjct 1024 LIATSVMARGIDIKNIILVINYQCPDHIEDYIHRIGRTGRSNNIGYAYTFILPNEYTKAY 1083 Query 202 ELEGAL------IQSGQNVPPALAALSSEFRV--QCNMGLAKKTKRGGFGGKGSHF 249 ++ L + ++P L + E+ N K K G+ GKG F Sbjct 1084 DIYNLLKNNIYYLNKTIDIPQDLENMIIEYTKINSINEKQKGKNKNLGYKGKGYKF 1139 Lambda K H 0.321 0.138 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 76840603367 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40