bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4022_orf2 Length=139 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G16930.2 85.9 3e-16 > 3702.AT2G16930.2 Length=154 Score = 85.9 bits (211), Expect = 3e-16, Method: Compositional matrix adjust. Identities = 42/67 (62%), Positives = 48/67 (71%), Gaps = 0/67 (0%) Query 11 WATSKGGSATKNNRDSRPKFLGVKKFGGQFVLPGDILVRQRGTRFKAGEGVMRGGDDNLV 70 WAT K +TKN RDS PKFLGVKKFGG+ V+PG+I+VRQRGTRF G+ V G D L Sbjct 46 WATKKTAGSTKNGRDSNPKFLGVKKFGGESVIPGNIIVRQRGTRFHPGDYVGIGKDHTLF 105 Query 71 ALNSGFV 77 AL G V Sbjct 106 ALKEGRV 112 Lambda K H 0.319 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40