bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3963_orf2 Length=159 Score E Sequences producing significant alignments: (Bits) Value 59463.ENSMLUP00000000075 157 1e-37 > 59463.ENSMLUP00000000075 Length=217 Score = 157 bits (396), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 91/159 (57%), Positives = 102/159 (64%), Gaps = 0/159 (0%) Query 1 PPPNFSVGFLGAHRHCDEPKAGDFPPRDMGGLKNLPKIKKRVKKRPKKYDAFWPSDFLIK 60 P P FSV LG +HCDE KA D P DM LK L K KK VKK +KYDAF S+ LIK Sbjct 59 PRPKFSVCVLGDQQHCDEAKAMDIPHMDMEALKKLNKNKKLVKKLGRKYDAFLASESLIK 118 Query 61 QFPRFLGPALNKAGNFPSLLPPNENMGPKVEEGRSPSNFQIKKVLFLAGAFAPVKRPDEE 120 Q PR LGP LNKAG FPSLL NENM +V+E +S FQ+KKVL LA A VK D+E Sbjct 119 QIPRILGPGLNKAGKFPSLLTHNENMVARVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDE 178 Query 121 LGSNIPLGFNFRGSLPKKNGQNVGALSFKAPRGKPRGFF 159 L NI L NF SL KKN QNV AL K+ GKP+ + Sbjct 179 LVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217 Lambda K H 0.319 0.143 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40