bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3953_orf2 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5207.CNE01090 145 3e-34 > 5207.CNE01090 Length=288 Score = 145 bits (366), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 73/144 (50%), Positives = 95/144 (65%), Gaps = 5/144 (3%) Query 4 MLRRTARLRKEYLFRKSLEEKERQLAERKQQVKETLETGKPLPTNLRAAAAAAAAARLAQ 63 MLRR R R+EY+F+KS E +ER + ERKQ++K+ L GKPLPT LR L Sbjct 1 MLRRQTRERREYIFKKSQESQERAIYERKQKIKDLLAQGKPLPTELRNEVRELGGKDLV- 59 Query 64 VLDLDDPQTLAPKTHVDDEYAYAGVEDPSIALTTSRSPSSRLQQFVKELNLLLPNCRRIN 123 LD+ Q P++H+DDEYA G DP I +TTSRSPSSRL QF KEL L+ PN R+N Sbjct 60 ---LDEAQQ-DPRSHIDDEYAKVGTYDPKIVITTSRSPSSRLLQFSKELRLVFPNSYRLN 115 Query 124 RGTIVLDELLQLCRSSGITDLLLV 147 RG V+ +L+ C + G+TDL++V Sbjct 116 RGNTVVKDLVSACNAQGVTDLVVV 139 Lambda K H 0.317 0.132 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40