bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3947_orf2 Length=83 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G16780.1 100 1e-20 > 3702.AT3G16780.1 Length=209 Score = 100 bits (249), Expect = 1e-20, Method: Compositional matrix adjust. Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 0/82 (0%) Query 1 LKCGRGRFWLDPNEAGDIAMANSRFSVRELLRDNLIIREAVAVDSKYRFRLYQQAKRQGR 60 +KCG+G+ WLDPNE+GDI+MANSR ++R+L++D IIR+ + S+ R R +AKR+GR Sbjct 15 MKCGKGKVWLDPNESGDISMANSRQNIRKLVKDGFIIRKPTKIHSRSRARALNEAKRKGR 74 Query 61 HMCIAMRQVTLDAPLPAKVLWM 82 H R+ T +A LP K+LWM Sbjct 75 HSGYGKRKGTREARLPTKILWM 96 Lambda K H 0.329 0.139 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22659344793 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40