bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3928_orf1 Length=280 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1185w 214 3e-54 > 5833.PFF1185w Length=2719 Score = 214 bits (545), Expect = 3e-54, Method: Composition-based stats. Identities = 110/261 (42%), Positives = 159/261 (60%), Gaps = 25/261 (9%) Query 3 GNMLVHCARCPTSFCYDCFPPDYCRYNVGEDYYMQLRQRGMNVTPQNWILFLCSKCKAVE 62 GN+L+HCA CPTSFCY+CFPPDY RY VGE+YY LRQRG+N TPQNW+ FLCSKCKAVE Sbjct 1509 GNLLIHCATCPTSFCYNCFPPDYVRYYVGEEYYHNLRQRGVNFTPQNWVCFLCSKCKAVE 1568 Query 63 EQQTRRRLTKEEKDHEKLMQQELRQQQRQLHLDGARLRLEKDEVKHLQRQRAEEERRWFD 122 EQ+ RR++TKEE+++EK +Q+ELR QLH D + LE + K + Q+ E ++ + Sbjct 1569 EQKKRRKMTKEERENEKQLQKELRS---QLH-DSKQEELEAKKRK--RAQQLERDKFIIE 1622 Query 123 HKQAVDRLDEAAEIALRQAYQRLFPAAFLAEIEKRSAAAKAAQRASREAAIAEAVNAAAA 182 +++ +D LD+ E LR+AY+ +FP F+ E+ R AK ++ Sbjct 1623 NRKRIDALDQQYEDQLRKAYENVFPNNFVKELVNRIEHAKMLKQ---------------- 1666 Query 183 AGTEGQAALASAAAAAIKKASKKPTNQLANMKLPSQSLSVCDNCRFPCHXVKDYPGPCCF 242 +G + K+ +KK + + KLPS+ L +C+NC+ PCH YPG CC+ Sbjct 1667 ---KGIVEDNNNNNNNNKETNKKKSTTFLHTKLPSKLLVLCENCKLPCHANYKYPGKCCY 1723 Query 243 PDEVIQKFVARARPVSQTGQE 263 P E+ + + SQ G++ Sbjct 1724 PPELDKSYYMSNTSFSQMGRD 1744 Lambda K H 0.319 0.130 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 92794370130 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40