bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3895_orf4 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0019 193 2e-48 > 5833.PF08_0019 Length=323 Score = 193 bits (490), Expect = 2e-48, Method: Compositional matrix adjust. Identities = 91/163 (55%), Positives = 110/163 (67%), Gaps = 0/163 (0%) Query 1 DWVSCVRFFPFPKEPLIFLCGWDKLVKVWSLTTCKLPANLVGQTFVLYTVTVSPDGSLCA 60 DW++CVRF P P + +I CGWDKLVKVW+L C L NL G T VL TVT+SPDGSLCA Sbjct 158 DWITCVRFSPSPNQAIIVSCGWDKLVKVWNLKNCDLNKNLEGHTGVLNTVTISPDGSLCA 217 Query 61 FGGKDGVTILWDLSEGKHLFSLDGSCPINSLGFFPCKYWVGGATDKFFKIWAPEKKKVLD 120 GGKDGV LWD+ EGKHL+SL+ INSL F PC YW+ ATD+F +IW E K ++ Sbjct 218 SGGKDGVAKLWDVKEGKHLYSLETGSTINSLCFSPCDYWLCAATDRFIRIWNLESKLIIS 277 Query 121 DISPDHPVKRGIPWGPFFNWSYEGRPLFIGSAGGNIPVYEVAE 163 +I P K G+PW WS G+ L+ GS GNI VYEV + Sbjct 278 EIYPVKQSKIGVPWCTSLTWSANGQLLYCGSTDGNIYVYEVKK 320 Lambda K H 0.324 0.145 0.512 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40