bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3821_orf1 Length=211 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000002342 96.7 4e-19 > 69293.ENSGACP00000002342 Length=268 Score = 96.7 bits (239), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 55/143 (38%), Positives = 84/143 (58%), Gaps = 6/143 (4%) Query 42 QEQHLQPVLCSVIAEHLNQGNGSSIHE--GESEVQRLPPALERLVMQEIGMPGATLLDWD 99 +E HL P++ +V+ + L G SS + ++ PAL ++ E+G+ LLD++ Sbjct 41 KENHLVPIIATVVQDELETGCASSGDASCAANTAEKHHPALVTVLCSELGVEPEALLDFE 100 Query 100 LCLMDATPGRLAGIHLEFIESPRLDNLASTFAAFEALVETSIRQRRGEQDCGETEILMAV 159 LCL D P L G++ EFI SPRLDNL S + A +AL+E+ G+ + + M Sbjct 101 LCLTDTQPAALGGVYEEFIYSPRLDNLHSCYCALQALIESC----SGDSLSKDPNVRMVT 156 Query 160 AFDHEEVGSESLAGANSSLLELL 182 +D+EEVGSES GA+S+L EL+ Sbjct 157 LYDNEEVGSESAQGASSNLTELI 179 Lambda K H 0.319 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53680939224 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40