bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3706_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P2.20 194 7e-49 > 5833.MAL3P2.20 Length=142 Score = 194 bits (494), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 90/136 (66%), Positives = 109/136 (80%), Gaps = 1/136 (0%) Query 48 MSEAVVVPRSFRLLDELEKGQKGQVAEGVSFGLEEADDITLTNWSGTIFGPPGTAFENRI 107 MSE V+VPRSFRLLDELE+GQKG V+EGVSFGLE ADDITL+NWS TIFG PGT FENRI Sbjct 1 MSE-VIVPRSFRLLDELERGQKGNVSEGVSFGLESADDITLSNWSCTIFGQPGTVFENRI 59 Query 108 YSVSINCGPLYPDAPPDVRFRTRINMHAVDPNGTVVKNSFPLLRQWQRSYTIDMLLTALR 167 YS++I C YPD+PP V+F T+I M VD G V+KN+ +L+ W R+YTI+ +L +LR Sbjct 60 YSLTIFCDDNYPDSPPTVKFDTKIEMSCVDNCGRVIKNNLHILKNWNRNYTIETILISLR 119 Query 168 QEMAAQANRRLPQPPE 183 QEM + AN+RLPQP E Sbjct 120 QEMLSSANKRLPQPNE 135 Lambda K H 0.315 0.129 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38900011563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40