bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3682_orf1 Length=128 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_1660 124 1e-27 > 5807.cgd1_1660 Length=107 Score = 124 bits (310), Expect = 1e-27, Method: Compositional matrix adjust. Identities = 60/104 (57%), Positives = 81/104 (77%), Gaps = 0/104 (0%) Query 24 STSTGIRVGLNKGFLVTKRATPPRPSRRKGKKTTRVQAIREIIRQVAGFAPYERRVLDLI 83 S STG VGLN GF+VTKR PRPS RKGK + R +R++IR+VAGFAPYE+R+++L+ Sbjct 4 SISTGTVVGLNTGFIVTKRPQRPRPSSRKGKLSARNALVRQVIREVAGFAPYEKRMMELL 63 Query 84 KIGSAATTKRALKFAKKRLGTHKRGKAKREELSNIAAAMKKKAA 127 K+GSA+T KRA++FA+ RLGT +R K KR+EL +I +K+AA Sbjct 64 KVGSASTAKRAMRFARARLGTERRAKKKRDELVDIIQQQRKRAA 107 Lambda K H 0.322 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22424899233 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40