bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3668_orf2 Length=151 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000132911 79.0 4e-14 > 31033.SINFRUP00000132911 Length=84 Score = 79.0 bits (193), Expect = 4e-14, Method: Compositional matrix adjust. Identities = 38/87 (43%), Positives = 47/87 (54%), Gaps = 4/87 (4%) Query 55 LEVLAVHTVGVCRWKEVPEDLHCVICDNPFELPCAACDTPGDECPPAFGACGHIFHLHCI 114 ++V H GV W V D +C IC PF C C PGD+CP +G C H FH+HCI Sbjct 1 MKVKIRHWNGVASWTWVANDENCGICRMPFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI 60 Query 115 AAWLGGRGLRGAAQDTCPMCRQLWRFA 141 WL + + Q CPMCRQ W+F Sbjct 61 LKWLNSQQV----QQQCPMCRQEWKFK 83 Lambda K H 0.331 0.145 0.525 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22675567716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40