bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3615_orf4 Length=239 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0115 165 1e-39 > 5833.PF08_0115 Length=675 Score = 165 bits (417), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 80/177 (45%), Positives = 117/177 (66%), Gaps = 4/177 (2%) Query 63 SSTTNSSSSSSSSSSSSKVADTRYYEVLEVQPNASFAEIKKAYYRLALKCHPDKNPGDPE 122 SS +N + + S ++ DT YY+ L ++P A +EIK +YY+LALK HPDKN DPE Sbjct 225 SSNSNMNDFNVSDCGNNTCVDTTYYDALNIKPTAKLSEIKTSYYKLALKYHPDKNANDPE 284 Query 123 AHKKFQAIGEAYQVLNDPKRRKDYDTFGVSATKTINFIDPALFFMMLFGSEQLDPYTGKL 182 A KFQ I EAYQVL+D +RR+ Y+ +G++ATK + IDP++FFMMLF SE+L YTG L Sbjct 285 AKLKFQKINEAYQVLSDDERRRQYNKYGLNATKDMILIDPSIFFMMLFSSEELSDYTGTL 344 Query 183 KMAKLLEVLTQDDFMSTVSGEGGVDLREGIMKALEEDQKKREVSLALQLREKVQSFV 239 ++A +++ F +S E + ++ +E +QK REV LAL LR+++Q +V Sbjct 345 RIAFFVQLA----FEGNMSIEDKKSSNQVMINEMEVEQKIREVELALLLRKRLQPYV 397 Lambda K H 0.304 0.120 0.323 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 69865650655 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40