bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3612_orf2 Length=184 Score E Sequences producing significant alignments: (Bits) Value 5085.AFUA_1G03080 144 1e-33 > 5085.AFUA_1G03080 Length=420 Score = 144 bits (363), Expect = 1e-33, Method: Compositional matrix adjust. Identities = 74/176 (42%), Positives = 105/176 (59%), Gaps = 15/176 (8%) Query 3 VLDVVEGTALAALPQMAAFVSRFPSLFTSCKEAVNWSIFAGLLCNRSSAAISIPSQLVKT 62 VLDVVEG+A+ AL M ++S PS F S V W + + NR+SA +S+PS L K Sbjct 221 VLDVVEGSAMDALQSMEKYLSTRPSRFPSLTSGVEWHTRSRTIRNRASARVSVPSLLYKE 280 Query 63 TRGALPASHKGADKGPPDEEVWTWRVDVMATEPYWEGWFRGMSHAFLSSRCVKILICSSS 122 + PA + W WR ++ AT+P+WE WF G+S FL +R K+L+ + + Sbjct 281 ETPSDPA------------KPWVWRTNLSATKPFWEDWFIGLSRKFLEARGGKLLLLAGT 328 Query 123 DRLDKELMIAHMQGKFQVQIVSGSGHVIEEDQPAELCRVVQTFITRYR---LHLPP 175 DRLDKELMI MQGK+Q+Q++ +GH I+ED PA+ +++ F R L LPP Sbjct 329 DRLDKELMIGQMQGKYQLQVLPEAGHFIQEDMPAKTAQILVDFYKRNDRSALVLPP 384 Lambda K H 0.322 0.134 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40