bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3582_orf1 Length=189 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0368 194 9e-49 > 5833.PF14_0368 Length=195 Score = 194 bits (494), Expect = 9e-49, Method: Compositional matrix adjust. Identities = 86/165 (52%), Positives = 117/165 (70%), Gaps = 0/165 (0%) Query 25 MAFLVGREAPDFTCEAVMPDGSFDTVSLRAFRGKKYVLLLFYPFDFTFVCPSELLAFSRA 84 MA VGREAP F EAV D +F V+L F GKKYVLL FYP DFTFVCPSE++A +A Sbjct 1 MASYVGREAPYFKAEAVFADNTFGEVNLHDFIGKKYVLLYFYPLDFTFVCPSEIIALDKA 60 Query 85 AADFEARDVQLLACSVDSKFAHSAWRAQEPQRGGLGPLALPLLADVRREVAAAFGVLLPD 144 F+ R+V+L+ CSVDSK+ H AW+ +GG+G + L++D+ + ++ ++ VL D Sbjct 61 LDAFKERNVELIGCSVDSKYTHLAWKKTPLTKGGIGNIQHTLISDITKSISRSYNVLFGD 120 Query 145 GMALRGLFLVDREGRVQHALVNGLAIGRSVPEALRVVDALQHHER 189 ++LR L+D++G VQH LVN LAIGRSV E LR++DA+QHHE+ Sbjct 121 SVSLRAFVLIDKQGVVQHLLVNNLAIGRSVEEVLRIIDAVQHHEQ 165 Lambda K H 0.325 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41818451300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40