bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3547_orf5 Length=199 Score E Sequences producing significant alignments: (Bits) Value 5833.PF10_0330 282 5e-75 > 5833.PF10_0330 Length=191 Score = 282 bits (721), Expect = 5e-75, Method: Compositional matrix adjust. Identities = 132/193 (68%), Positives = 156/193 (80%), Gaps = 5/193 (2%) Query 7 QISSSRKQCDFAKLLMAGYDLELNNKNTQDFNVVFHGPKETIYEGGVWRVHVTLPDDYPF 66 Q S +RKQCDF KL+MAGYDLELNN +TQDF+V+FHGP T YEGG+W+VHVTLPDDYPF Sbjct 4 QTSLTRKQCDFTKLIMAGYDLELNNGSTQDFDVMFHGPNGTAYEGGIWKVHVTLPDDYPF 63 Query 67 SSPSIGFLNKILHPNVDEASGSVCLDVINQTWTPLYSLVNVFDVFLPQLLTYPNPQDPLN 126 +SPSIGF+NK+LHPNVDEASGSVCLDVINQTWTPLYSLVNVF+VFLPQLLTYPNP DPLN Sbjct 64 ASPSIGFMNKLLHPNVDEASGSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLN 123 Query 127 SEAASLLNRDKAQYEQKVKEHVKKYASRDSWEKEQARRKEEAARERMREEQEPEAGELSR 186 S+AASLL +DK YE+KVKE+VK YAS+D WE+++ +K + ELS Sbjct 124 SDAASLLMKDKNIYEEKVKEYVKLYASKDLWEQQKKEKKPSNINGNIS-----PVSELSY 178 Query 187 VDDEADGADIDDL 199 VD + D+D+L Sbjct 179 VDQDVQDIDLDNL 191 Lambda K H 0.313 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47162034073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40