bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3513_orf6 Length=209 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.275 117 3e-25 > 5833.MAL13P1.275 Length=1288 Score = 117 bits (293), Expect = 3e-25, Method: Composition-based stats. Identities = 56/145 (38%), Positives = 79/145 (54%), Gaps = 19/145 (13%) Query 6 FDEPGVTHVMAGKSNTNNMLALKERSFQHLKKVHTLWLFACESMWAKAPESCFDADALCA 65 +DEPGVTH++A K+ T+N++ K+ + H+ KVHTLWL+ C K S FDAD LC Sbjct 1108 YDEPGVTHIIAAKNCTDNLIKSKKSDYDHILKVHTLWLYHCRGTLEKRHSSNFDADNLCK 1167 Query 66 LYDNQPPCAPFKDHWMHLAEFVPPPAVAPAQPLPLQ---------DRLPVREFLGTGPYS 116 +Y N+PP P KDHW P + Q + L +R FLGTG Y+ Sbjct 1168 IYSNKPPLHPKKDHWF----------FGPKEDFKKQEDNKDCVKIENLKIRTFLGTGEYT 1217 Query 117 DGASLISPFEETIFLWRPEKQPIRQ 141 + A + SPFE+ W ++ +RQ Sbjct 1218 NDAVIFSPFEQINIKWIEKEVTLRQ 1242 Lambda K H 0.319 0.134 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53286973563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40