bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3511_orf2 Length=146 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC30D10.03c 80.5 1e-14 > 4896.SPBC30D10.03c Length=405 Score = 80.5 bits (197), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 41/102 (40%), Positives = 61/102 (59%), Gaps = 5/102 (4%) Query 34 KGMHKETLEEAVMRIRRDIRMAFGADFAVPYSVFSGGCDIWVDAGNKAEGVALLQGLLQL 93 + + +E LEEAV+ + +++ +F+VP++ F+GG DIW D G+K GV LQ + Sbjct 298 QKLRREQLEEAVLETQATLQIR---NFSVPFTAFNGGNDIWCDIGDKKLGVLCLQHFFNI 354 Query 94 -LPQQCLHVGDQFSLVG-NDLAARICSPALWIRNPRETAAVL 133 P +CLHVGDQF G ND AR + +W+ +P ET L Sbjct 355 SHPSRCLHVGDQFLSAGNNDYKARAAATTVWVSSPHETIEFL 396 Lambda K H 0.321 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40