bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3463_orf1 Length=198 Score E Sequences producing significant alignments: (Bits) Value 338963.Pcar_2672 73.9 3e-12 > 338963.Pcar_2672 Length=399 Score = 73.9 bits (180), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 21/137 (15%) Query 47 GAVLKGVVKNIRPFGAFILTSQYARECLLHISNISRQRVENVEDALKMGQ--EVWVKVLK 104 G V+KG V ++R FGAFI E LL IS IS RVEN+ED L +GQ E+ +K L Sbjct 204 GMVVKGTVTSLRDFGAFIDIGGL--EGLLPISEISYGRVENIEDVLHVGQELELAIKKLD 261 Query 105 EEPDGRVSVSMKDVNQEDGSEITSLFDSFNNRGVGGGVKIPELNSIHRGTVKRIQAFGAF 164 + D R S S++D + S++ +L+ S H GTV R+ FGAF Sbjct 262 WQAD-RFSFSLRDTQADPWSKVGTLYME---------------GSTHTGTVARLANFGAF 305 Query 165 VALDGFDRDGLLHISCI 181 V L+ DGL+HIS + Sbjct 306 VTLE-EGVDGLIHISKL 321 Lambda K H 0.320 0.139 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46549540124 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40