bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3442_orf2 Length=226 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000001729 77.4 3e-13 > 13616.ENSMODP00000001729 Length=384 Score = 77.4 bits (189), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 40/101 (39%), Positives = 57/101 (56%), Gaps = 3/101 (2%) Query 29 VLAELQMAFIAGVLGHHYPSLVHWKDLLQLVCNSERALYLYPELFSKFIDTFYAQLEQAP 88 VLAELQ AFI ++GH Y + HWK LL L+C +E A+ Y +L+S+ I Y +L + P Sbjct 251 VLAELQFAFICFLIGHVYDAFEHWKQLLNLLCRAEEAIGKYSDLYSRLISILYHELNEIP 310 Query 89 DELTELEPLQQNNLLTSCCAALLEFCCS--VDRQAARAALK 127 + ++ + Q+N LTS + CS VD R A K Sbjct 311 ADFF-VDIISQDNFLTSTLQVFFSYICSTTVDETLRRKAEK 350 Lambda K H 0.318 0.127 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 61967794494 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40