bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3413_orf1 Length=154 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000156728 80.9 1e-14 > 31033.SINFRUP00000156728 Length=567 Score = 80.9 bits (198), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 40/113 (35%), Positives = 62/113 (54%), Gaps = 0/113 (0%) Query 8 SAQFLVEKSGLWDSWGLSATQVKTGQQWDKPNCWPPLVQMAVEAIINLEDQALLSAIKCM 67 + Q+L L G+ + ++GQQWD PN WPPL M +E + N+ + + Sbjct 427 AVQYLKRSGALQYPGGIPTSLKESGQQWDYPNAWPPLQHMLIEGLSNVASEEAKQLASEL 486 Query 68 TDKYIFACTQAYNRLGALPEKSNSLISGSCGSGGDYKCQIGFGWSIGVALELL 120 ++I + AY + A+ EK + G G+GG+Y Q+GFGW+ GVAL+LL Sbjct 487 AQRWIRSNWLAYTKHKAMFEKYDVRQEGEPGAGGEYNVQLGFGWTNGVALQLL 539 Lambda K H 0.320 0.132 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23121682173 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40