bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3411_orf2 Length=102 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_2110 99.0 4e-20 > 5807.cgd4_2110 Length=635 Score = 99.0 bits (245), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 46/77 (59%), Positives = 53/77 (68%), Gaps = 6/77 (7%) Query 17 LSGWEYTNHAVTIVGWGETGSGSGSDPQKYWIVRNTWGPQWGLKGFFLLERGNNSGGIEN 76 L+GWEYTNHA+ IVGWGE YWI+RN+WG WG KG+ + RG N GGIEN Sbjct 527 LNGWEYTNHAIAIVGWGEENG------IPYWIIRNSWGANWGKKGYAKIRRGKNIGGIEN 580 Query 77 QTSFIDPDLTRGKGLAL 93 Q FIDPD TRG GL+L Sbjct 581 QAVFIDPDFTRGMGLSL 597 Lambda K H 0.315 0.134 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40