bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3392_orf2 Length=159 Score E Sequences producing significant alignments: (Bits) Value 5141.NCU07914.1 166 3e-40 > 5141.NCU07914.1 Length=418 Score = 166 bits (419), Expect = 3e-40, Method: Compositional matrix adjust. Identities = 84/139 (60%), Positives = 104/139 (74%), Gaps = 8/139 (5%) Query 22 LASKVGIEQVADQLKGKRVLMRVDFNVPLK-DGKVADATRIAATIPTIKFALQHGARAVL 80 L++K+ IE V LKGKRVL+RVDFNVPL + KV + RIA IPTIK+AL HGA+AV+ Sbjct 3 LSNKLSIEDV--DLKGKRVLIRVDFNVPLDAEKKVTNPQRIAGAIPTIKYALDHGAKAVV 60 Query 81 LLSHCGRPDGRVQQQYSLRPVVPVLQQLLQQQQLSSKVSFVEDCVGPQAEAAAANAQNGE 140 L+SH GRPDG+ +YSL+PVVP L++LL + KV+F DCVGP+ E A NGE Sbjct 61 LMSHLGRPDGKPNPKYSLKPVVPELEKLLGK-----KVTFAPDCVGPEVEEIVNKADNGE 115 Query 141 VLLLENLRFHLEEEGKGED 159 V+LLENLRFH+EEEGKG D Sbjct 116 VILLENLRFHIEEEGKGTD 134 Lambda K H 0.321 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26246233818 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40