bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3328_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5671.LinJ32.3870 132 4e-30 > 5671.LinJ32.3870 Length=476 Score = 132 bits (331), Expect = 4e-30, Method: Composition-based stats. Identities = 61/92 (66%), Positives = 80/92 (86%), Gaps = 1/92 (1%) Query 39 QRSFSSQSEYDVVVIGGGPGGYVAAIKAAQLGLKTACVEKRGALGGTCLNVGCIPSKALL 98 +R+ + + YDV VIGGGPGGYVAAIKAAQLGLKTAC+EKRGALGGTCLNVGCIPSKALL Sbjct 3 RRNIAHLASYDVTVIGGGPGGYVAAIKAAQLGLKTACIEKRGALGGTCLNVGCIPSKALL 62 Query 99 NMSHKYKEASSDFSRFGIRVSD-VSVDISSMQ 129 + +H Y +A ++F+++G+R + V++D+S+MQ Sbjct 63 HATHLYHDAHANFAQYGLRGGENVTMDVSAMQ 94 Lambda K H 0.321 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40