bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3304_orf3 Length=171 Score E Sequences producing significant alignments: (Bits) Value 59463.ENSMLUP00000003414 129 3e-29 > 59463.ENSMLUP00000003414 Length=430 Score = 129 bits (324), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 66/132 (50%), Positives = 90/132 (68%), Gaps = 1/132 (0%) Query 40 AAAAAAAAAAAAAAAAAAAMSLFAAVPLAPPDPILGLAQAFKEDQNPKKVDLGVGAYRTE 99 + AAAA A A+A A S +A V + PPDPILG+ +AFK D N KK++LGVGAYR + Sbjct 11 SGAAAAFHPGLAGVASARASSWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD 70 Query 100 DGKPYVFKAVRMAEEQIMSDPTVNKEYLPIDGLPELKELTQKLLFGEDLAAAAAGRIVSL 159 +GKPYV ++R AE QI + ++KEYLPI GL E + + +L GE+ +GR V++ Sbjct 71 NGKPYVLPSIRKAEAQIAAK-NLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRYVTV 129 Query 160 QTLSGTGALRLA 171 QT+SGTGALR+ Sbjct 130 QTISGTGALRIG 141 Lambda K H 0.318 0.128 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40