bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3299_orf1 Length=171 Score E Sequences producing significant alignments: (Bits) Value 357808.RoseRS_0190 107 1e-22 > 357808.RoseRS_0190 Length=272 Score = 107 bits (268), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 57/151 (37%), Positives = 86/151 (56%), Gaps = 9/151 (5%) Query 22 SFLQKLTRRIKEHGTILCVGIDP-PLACPTTDDLRGSNRQQLLEDLHEKCVCLIRRTSDF 80 +F + + + + + LC+G+DP P+ P + E ++ C ++ TSD Sbjct 2 TFRETVCATARRNRSWLCIGLDPEPMRMPV-------HLPADAEGVYAFCAAIMDATSDL 54 Query 81 VCCFKPNVAFFEQYGSGGMEVLQRLCREIPEDIPIILDAKRAATDEAAEAMANAFYSAYN 140 VC FKPN+AFFE +G+ G L+RL R P PIILDAKR AEA A A + + Sbjct 55 VCAFKPNIAFFEAFGAAGWSALERLIRLRPGP-PIILDAKRGDIGSTAEAYARAAFEVLD 113 Query 141 ADCVTLDPYLGEGAILPFIKEKGKGVFVVCR 171 AD VT++PYLG A+ PF++ +G F++C+ Sbjct 114 ADAVTVNPYLGGDALEPFLRHSQRGCFILCK 144 Lambda K H 0.324 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32237076404 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40