bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3247_orf1 Length=247 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1670c 259 4e-68 > 5833.PFI1670c Length=221 Score = 259 bits (663), Expect = 4e-68, Method: Compositional matrix adjust. Identities = 123/218 (56%), Positives = 162/218 (74%), Gaps = 0/218 (0%) Query 24 MVKFILNEAKDKAQEIEARALEDFNIEKLKLVQQMKDKIRQEFDKKAKKLEVQRSIDRST 83 MV FILNEAKDKA EIEA+ALEDFNIEKL++VQ+MK+KIR EF KKAK++E++RSI RS+ Sbjct 1 MVNFILNEAKDKAHEIEAKALEDFNIEKLRIVQKMKEKIRVEFQKKAKQMEIKRSIARSS 60 Query 84 AINKARLRRIAAQDQVVTEVYAQSQKQLATICSDTARYKELLTDLIVQGLLRLLEPEVVI 143 AINKARL+++ A+DQV E+Y S +L + D +YK L+ DLIVQ L + EP V++ Sbjct 61 AINKARLKKMCAKDQVFKEIYKISSDKLNDLYKDKDKYKNLIVDLIVQSLFYMQEPHVIV 120 Query 144 RCREVDRSVVESVLPAAAAKYSKILNDEAGLKKTVKLSIDKLGRYLPPPPTADSTVPSCC 203 RCR++D++VVES L A +KY+ L + + KTVK+ +DK G YLPPPPT ++ SC Sbjct 121 RCRDIDKAVVESSLNEAVSKYTDKLKKQFNVTKTVKIELDKSGNYLPPPPTPENEGNSCL 180 Query 204 GGVILVTADGRISCDNTLDARLKLVVTECAPAIRMHLF 241 GGVIL T + +I+CDNTLD RLKL + C P I+ F Sbjct 181 GGVILTTPNRKINCDNTLDVRLKLAIEYCTPEIKRMFF 218 Lambda K H 0.318 0.131 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 73815382762 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40