bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3211_orf1 Length=209 Score E Sequences producing significant alignments: (Bits) Value 4896.SPAC959.03c 77.0 4e-13 > 4896.SPAC959.03c Length=520 Score = 77.0 bits (188), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 50/124 (40%), Positives = 68/124 (54%), Gaps = 16/124 (12%) Query 91 QLPMDDPQSRTAKRSRG--------TIKRQRALEKKVQESVSAVTALLTETE-------G 135 +L ++D + T K SRG K+ R+ +K++E + V + L +TE G Sbjct 5 KLNLEDVNASTKKYSRGRKLNPKKIKDKKLRSNIQKIEERIENVESSLAKTEILHEDNPG 64 Query 136 YLEAEGLEKTYKFTQADILENVSEEIGKKAFRLGLS-FGPYFVDYTRGGRHLLLGGQKRE 194 LEAEGLE+TYKF Q + NV+ E K+F L L FG Y DYTR GR +LLGG+K Sbjct 65 LLEAEGLERTYKFRQDQLAPNVALETATKSFSLDLDKFGGYSFDYTRDGRMILLGGRKGH 124 Query 195 FGCF 198 F Sbjct 125 ISAF 128 Lambda K H 0.316 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53286973563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40