bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3208_orf2 Length=212 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2490 188 1e-46 > 5807.cgd1_2490 Length=246 Score = 188 bits (477), Expect = 1e-46, Method: Compositional matrix adjust. Identities = 89/153 (58%), Positives = 114/153 (74%), Gaps = 0/153 (0%) Query 60 FNPYVNNGGTVVCVAGEDFVIGVGDTRLSVGYSIHSRHHSKITQLTSRCCIASSGMQADI 119 FNPY+NNGG+ V VAG+DFV+ DTRLS Y I SR SK QLT++C +A SGM ADI Sbjct 37 FNPYMNNGGSCVAVAGDDFVVIAADTRLSKMYRIASRSVSKTCQLTNKCILACSGMLADI 96 Query 120 NTLHKLLKARVAVYRHLHRAEPSGPALSQLLSSLLYSRRFFPFYTFNLLFALDEEGKGAV 179 N L K L A+V +Y H PS A++QLLS +LYS+RFFP+Y+F LL LDE+GKG V Sbjct 97 NALRKTLLAKVKLYEFEHNKTPSINAIAQLLSCILYSKRFFPYYSFCLLSGLDEQGKGVV 156 Query 180 FGYDAIGSFERSSFNAAGTGGPLVTALLDNQIA 212 +GYDA+GSF++ F A G+GG L+T++LDNQI+ Sbjct 157 YGYDAVGSFDQHKFVALGSGGSLITSILDNQIS 189 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54290949897 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40