bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3186_orf1 Length=167 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0328 132 6e-30 > 5833.PF14_0328 Length=162 Score = 132 bits (331), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 65/119 (54%), Positives = 83/119 (69%), Gaps = 2/119 (1%) Query 6 KGWRNSPKYEKFNGAMFSGTLKSPAVGSAFATWGGIFCAFDCTLAYARGGKEDSWNPVLA 65 KG RNSPK + +GA++S +++P +G FA WGG F FDC Y R KED WN + + Sbjct 38 KGARNSPKGDVLSGALYSSRMRAPILGGNFAVWGGTFSCFDCAFQYMRK-KEDHWNAIGS 96 Query 66 GAATGGVLSMRSGWKSCARNAVVGGVLLGIIEVVQIMFLRGTPTITPRKQFQQMKEYEE 124 G TGGVL+MR GW+S +RNA+VGGVLL IIE+V I+ R T T TPR+QFQQ E E+ Sbjct 97 GFCTGGVLAMRGGWRSASRNAIVGGVLLAIIEIVSIVLTRKT-TPTPRQQFQQQMELEK 154 Lambda K H 0.318 0.131 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30498925597 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40