bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3142_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_950 151 6e-36 > 5807.cgd5_950 Length=425 Score = 151 bits (381), Expect = 6e-36, Method: Compositional matrix adjust. Identities = 67/131 (51%), Positives = 92/131 (70%), Gaps = 1/131 (0%) Query 1 DILECLVAARLRMGKLPSADLLNKYQMPHYLDIIKAMKSGNLSLFDRALEQHESVFIKHG 60 +ILECL+ + R+G +P+ LL KY + HY +I KA+ GN+ FD A+E++ S+FI HG Sbjct 269 NILECLIPVKFRLGFIPNISLLKKYNLEHYFEISKAILQGNIKRFDAAIEKYSSLFINHG 328 Query 61 TILCVERLKFIVFRTLMKRMKQWWLESGLASKANIVPIQVFTAAIKWQSDELFDDDEMAC 120 TILC+E++KFI++R LM+R++ W L N + VF A KWQSDELFD EMAC Sbjct 329 TILCIEKVKFILYRNLMRRIRN-WCRKNLKGDPNKLTFSVFDAGFKWQSDELFDQQEMAC 387 Query 121 ISANLIRMGYI 131 I ANLI++GYI Sbjct 388 ICANLIKLGYI 398 Lambda K H 0.327 0.139 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40