bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3138_orf1 Length=170 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P2.19 104 8e-22 > 5833.MAL1P2.19 Length=232 Score = 104 bits (260), Expect = 8e-22, Method: Compositional matrix adjust. Identities = 44/92 (47%), Positives = 65/92 (70%), Gaps = 2/92 (2%) Query 13 LEVGEFLGEWWRGEFDDDLVPYLPPHVTRPKERVRVHQVQLPHRCSFRIPVGFCLTVVPI 72 +E+G+FLGEWWR +F+ +PYLP H++RPKE +R++QV L +C F +P GF L +P+ Sbjct 140 VEIGDFLGEWWRTQFNSVFLPYLPAHISRPKEYIRLYQVILSPKCIFHLPPGFTLKAIPL 199 Query 73 FELSPQRVGLAIGGLSHLIARFSIRLMVPTLD 104 F+L+ GLAI GLS +++RF + MV D Sbjct 200 FDLN--NCGLAISGLSSILSRFKLHCMVQEQD 229 Lambda K H 0.318 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 31617132627 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40