bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3134_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G23190.1 108 6e-23 > 3702.AT1G23190.1 Length=583 Score = 108 bits (269), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 46/86 (53%), Positives = 65/86 (75%), Gaps = 0/86 (0%) Query 16 SVRATTPFEGQKPGTSGLRRKTREFMQPGYLSNYVQAVFDCLPESEVRGGTMLVAGDGRY 75 S +T+P +GQKPGTSGLR+K + F QP YL N+VQA F+ L +V+G T++V+GDGRY Sbjct 6 STVSTSPIDGQKPGTSGLRKKVKVFKQPNYLENFVQATFNALTAEKVKGATLVVSGDGRY 65 Query 76 FCSDAIKKIVAIAAGNGVGRVWIAKD 101 + DA++ I+ +AA NGV RVW+ K+ Sbjct 66 YSKDAVQIIIKMAAANGVRRVWVGKN 91 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990353331 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40