bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3132_orf2 Length=187 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0313 157 1e-37 > 5833.PF11_0313 Length=316 Score = 157 bits (398), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 67/124 (54%), Positives = 97/124 (78%), Gaps = 0/124 (0%) Query 62 KRREYFPRLLQLLLEHPRVLVVSADHVGSKQLAGIRVALRGQATVLMGKNTKIRTALRQQ 121 K++ Y +L L+ ++ ++L+V D+VGS Q+A +R +LRG+AT+LMGKNT+IRTAL++ Sbjct 9 KKQMYIEKLSSLIQQYSKILIVHVDNVGSNQMASVRKSLRGKATILMGKNTRIRTALKKN 68 Query 122 LQQQPQLQALLPLVRLNVGFIFCRADPAAVRAVVQQHKVPAPAKQGVTAPTDVFIPAGPT 181 LQ PQ++ LLPLV+LN+GF+FC+ D + +R ++ +K PAPA+ GV AP DVFIP GPT Sbjct 69 LQAVPQIEKLLPLVKLNMGFVFCKDDLSEIRNIILDNKSPAPARLGVIAPIDVFIPPGPT 128 Query 182 GMDP 185 GMDP Sbjct 129 GMDP 132 Lambda K H 0.321 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40588496850 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40