bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3113_orf3 Length=221 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_2990 206 4e-52 > 5807.cgd2_2990 Length=207 Score = 206 bits (524), Expect = 4e-52, Method: Compositional matrix adjust. Identities = 97/191 (50%), Positives = 135/191 (70%), Gaps = 1/191 (0%) Query 17 LPNVHLRKEWQRFVRTWFDQPARKQRRRLQRQKKAAKLGVRPLGLLRPAVRCPTQKYNIK 76 +PNVH K ++R+++TW++QP RKQ RR+ RQK A+ G RP+G+LRP V PTQ+YN+K Sbjct 7 IPNVHYHKNYKRWIKTWYNQPGRKQSRRIARQKAVAEAGFRPVGMLRPIVHPPTQRYNMK 66 Query 77 LREGRGFTLEELKAVGISPRVALSIGISVDHRRRNRCQESLNTNVNRLKLYLSKLVLFQR 136 R GRGFTLEEL A GI+ + A+SIGI+VDHRR + +E+ NV+RLK Y++ +VL R Sbjct 67 TRLGRGFTLEELSACGINKKAAMSIGIAVDHRRTDLSEETFQINVDRLKKYINGIVLQPR 126 Query 137 -GSKAKKGLAGVPADTPKSQLQNVKQAKIADSLPIERPRKKIRARVITEEERKFRAYATL 195 G K KKG AG+P D+ + + + +K + PI+ ++ VIT EERKFRA++TL Sbjct 127 KGKKTKKGFAGIPNDSAREEFKALKNVSHEKAFPIKAQTLAVKTHVITPEERKFRAFSTL 186 Query 196 RKQLRDAKNVG 206 RKQ +AKN G Sbjct 187 RKQFIEAKNFG 197 Lambda K H 0.320 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 59781045954 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40