bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3076_orf1 Length=237 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0565w 116 7e-25 > 5833.PFL0565w Length=244 Score = 116 bits (290), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 63/128 (49%), Positives = 77/128 (60%), Gaps = 18/128 (14%) Query 59 DYYAILGVSRGASSEEIRKAYRKLAIKWHPDKNRERQQEATERFKAISEAYEVLSNDEKR 118 +YY +LGV + A I+K+YR LA+KWHPDKN + EATERFK ISEAYEVLS+ ++R Sbjct 6 NYYEVLGVPQDADLTVIKKSYRTLAMKWHPDKNPNNKAEATERFKQISEAYEVLSDPKRR 65 Query 119 RLYDISFSQPTEGPGLRRTASSAAAAAAAAAAAAEFARFHEAFQFSDAQRIFEMAFGG-S 177 R YD+ A EF+ FH+ F F+DAQRIFEM FG S Sbjct 66 RKYDL----------------YGTDENYMADENDEFSNFHKNFGFNDAQRIFEMFFGDSS 109 Query 178 PFGR-SFF 184 PFG SFF Sbjct 110 PFGNDSFF 117 Lambda K H 0.316 0.128 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 68650595861 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40