bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3027_orf1 Length=197 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_2160 113 3e-24 > 5807.cgd7_2160 Length=462 Score = 113 bits (283), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 54/145 (37%), Positives = 87/145 (60%), Gaps = 4/145 (2%) Query 57 LIFPPADMRGVIEKTAQFVAKNGAEFESRVLREQSATKFGFLLPNNPYHAFYKLKVREFT 116 LI+PP ++R I+KTA FVAKNG EFESR+L E + KF FL +NP+H +YK ++ +F Sbjct 9 LIYPPFELRATIDKTASFVAKNGEEFESRILSESGSIKFTFLNKDNPFHLYYKKRIEDFK 68 Query 117 TGEAAPT--PQVPQAIRDMQQKQQQEKQQQQQLLMLTQIGESEKEANKEQIEPPPPH--Q 172 G + P +P+AI DM +++++ ++++LMLT +EP P Q Sbjct 69 NGVSIDNSGPTIPRAILDMNSRKEKQIIAEKEVLMLTSFSGGFGFMGGAVMEPEEPRKDQ 128 Query 173 FVLQHPWVAPIDLDIIRCAAQFVAR 197 + + HP ++ D +I+ A ++AR Sbjct 129 YTISHPIISIKDESVIKITAMYLAR 153 Lambda K H 0.316 0.132 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46738269100 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40