bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2929_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0D16291g 94.4 8e-19 > 4952.YALI0D16291g Length=1018 Score = 94.4 bits (233), Expect = 8e-19, Method: Compositional matrix adjust. Identities = 46/72 (63%), Positives = 57/72 (79%), Gaps = 1/72 (1%) Query 37 RKLNFSSPEFVRNISILAHVDHGKTSLSDCLLATNGFITEASAAKLRFLDSRQDEQNRQI 96 RKL S P +RNI ILAHVDHGKTSLSDCLLA+NG I++ A KLR+LDSR DEQ R I Sbjct 9 RKLQ-SDPSSIRNICILAHVDHGKTSLSDCLLASNGIISQKMAGKLRYLDSRPDEQERGI 67 Query 97 TIKASVVSLLYQ 108 T+++S +SL ++ Sbjct 68 TMESSAISLHFR 79 Lambda K H 0.316 0.129 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40