bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2921_orf2 Length=130 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_3480 133 1e-30 > 5807.cgd8_3480 Length=138 Score = 133 bits (335), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 72/125 (57%), Positives = 91/125 (72%), Gaps = 1/125 (0%) Query 2 KMSTRLVFRRHNHYNTASNRVRRVKTPGAKVVYLNVRKQASRQRCGGCGRLLPGIPARRP 61 KMS R+ +RR YNT SNRVR VKTPG + + N+ K SR +CG C + L GIPA P Sbjct 3 KMSPRVTYRRKCRYNTPSNRVRVVKTPGGRNLIQNIGKVYSRPKCGDCKKPLAGIPACAP 62 Query 62 PQFRLLKKRERTVNRAYGGTRCHSCVREKVLRAFLVEEQKCVKQVLQVKERQKRDEVKTE 121 + + LKKRERTV RAYGGT+C +CVR+++LRAFL+EEQK VK V+ KE+QK+ E K + Sbjct 63 YEMKHLKKRERTVARAYGGTKCPTCVRQRILRAFLLEEQKVVKSVIAEKEQQKKSEEKPK 122 Query 122 -NKKS 125 NKKS Sbjct 123 VNKKS 127 Lambda K H 0.322 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40