bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2869_orf2 Length=173 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0049 132 3e-30 > 5833.PF13_0049 Length=162 Score = 132 bits (333), Expect = 3e-30, Method: Compositional matrix adjust. Identities = 61/102 (59%), Positives = 81/102 (79%), Gaps = 0/102 (0%) Query 20 MAGVQTTIKTELCSFSEYRIYPGRGLKFVSRDGKVHTYIHSKEARLGRQKKKAAKLRWTL 79 M+ ++TT+KTE CSFSEYRIYPGRG K+++RDGKV+ Y+ SK A L QKKKAAKLRWT Sbjct 1 MSQIKTTVKTEACSFSEYRIYPGRGQKYIARDGKVYFYLSSKFASLALQKKKAAKLRWTQ 60 Query 80 VWRRANKKSRGEAVAKRRTRKGGKVQKAIVGISLEEIKQRRA 121 WRR NKK++ E +RR +K KVQKA+ G+++E+I+ R+A Sbjct 61 TWRRNNKKTKIETTQRRRYKKTIKVQKAVCGLTVEDIRNRKA 102 Lambda K H 0.317 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 33476963958 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40