bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2867_orf1 Length=202 Score E Sequences producing significant alignments: (Bits) Value 4959.DEHA0D10351g 109 6e-23 > 4959.DEHA0D10351g Length=176 Score = 109 bits (272), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 61/118 (51%), Positives = 77/118 (65%), Gaps = 7/118 (5%) Query 62 KLRSSITPGTVLILLSSGFRGKRVVCLQQQQPSGLLLVTGPFAVNGVPLRRVNPRYVIAT 121 KLR+S+ PGTVLILL+ FRGKRVV L+ + LLV+GPF VNGVPLRRVN RYVIAT Sbjct 28 KLRASLVPGTVLILLAGRFRGKRVVYLKNLE-DNTLLVSGPFKVNGVPLRRVNSRYVIAT 86 Query 122 SSKINISEVDLSGVQQEMFV-----RSKQQEARAAQAAQQRRHF-ALRAAGRSAAAAA 173 S+K+N+ VD+S E F RSK+ EA AQ ++ A R A + + A+ Sbjct 87 STKVNVEGVDVSKFNVEYFAREKVPRSKKSEAEFFNEAQPKKEIKAERVADQKSVDAS 144 Lambda K H 0.318 0.127 0.348 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 48999515920 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40