bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2833_orf2 Length=191 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP010065-PA 243 2e-63 > 7165.AGAP010065-PA Length=165 Score = 243 bits (621), Expect = 2e-63, Method: Compositional matrix adjust. Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 0/164 (0%) Query 27 MAKKFDPNEIKYIYLRQTGGEVGASSVLAPKLGPLGMSPKKVGDDIAKATMAWKGLKVTV 86 M KFDPNE+K++YLR GGEVGA+S LAPK+GPLG+SPKK+GDDIAKAT WKGLK+TV Sbjct 1 MPPKFDPNEVKHVYLRCVGGEVGATSSLAPKIGPLGLSPKKIGDDIAKATGDWKGLKITV 60 Query 87 CLKVQNRQATVEVMPSASSLIIKELKEPPRDRKKVKNIKHNGNLTLQQVFQIARTMRSKS 146 CL +QNRQA + V+PSA+SLI+K LKEPPRDRKKVKNIKHNGN+T +V IAR MR +S Sbjct 61 CLTIQNRQAAISVVPSAASLIVKALKEPPRDRKKVKNIKHNGNITFDEVINIARVMRPRS 120 Query 147 LAHEFTGTVKEILGTCASIGCTVDGKAPTAVQAEIDSGEVEVPS 190 +A E GT KE+LGT S+GCT+DG++P V +I SG +E+PS Sbjct 121 MARELAGTCKEVLGTAQSVGCTIDGRSPHDVIDDISSGAIEIPS 164 Lambda K H 0.317 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40