bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2815_orf1 Length=185 Score E Sequences producing significant alignments: (Bits) Value 5270.UM02924.1 110 3e-23 > 5270.UM02924.1 Length=209 Score = 110 bits (274), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 50/81 (61%), Positives = 62/81 (76%), Gaps = 0/81 (0%) Query 11 VSRSAQLPNVHLRKEWQRFVRTWFDQPARKQRRRLQRQKKAAKLGVRPLGLLRPAVRCPT 70 V + L N H RK+WQR V+ WFDQP K+RRR R+ KAAKLG+RP+ LLRPAVRCPT Sbjct 3 VKHNNILHNNHFRKDWQRRVKVWFDQPGAKKRRRTAREAKAAKLGLRPVQLLRPAVRCPT 62 Query 71 QKYNIKLREGRGFTLEELKVS 91 +YN K+R GRGFT+EE+K + Sbjct 63 LRYNTKIRSGRGFTIEEVKAA 83 Lambda K H 0.328 0.135 0.482 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40134932565 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40