bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2799_orf1 Length=192 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1365c 85.9 7e-16 > 5833.PFF1365c Length=10287 Score = 85.9 bits (211), Expect = 7e-16, Method: Composition-based stats. Identities = 52/130 (40%), Positives = 63/130 (48%), Gaps = 23/130 (17%) Query 69 TVHPALPF----RVQFKG--NCWAGGAAGPQMVGIVWGYCRWLWFSNGRLSCPVDLPLGE 122 ++ PA PF V FK N + VGI+WG RWLW SNG+ CP+ LPL Sbjct 7372 SIFPAKPFIFNCTVNFKEEENYYHKKNYLTNSVGIIWGIYRWLWKSNGKFICPLRLPLCV 7431 Query 123 LMRLHAGGPPHVRRDSKIPSEGWREIQLTRGISGFTIRDTLEIEFQPAIPALLFKKNDVY 182 S+ PSE E ++ + G+ D L IEFQP LLF KN Y Sbjct 7432 ---------------SEFPSEKIEECEID--VVGYKSNDNLCIEFQPLYQCLLFYKNGTY 7474 Query 183 QFGFNFDKFY 192 QFGF FD FY Sbjct 7475 QFGFKFDTFY 7484 Lambda K H 0.321 0.140 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43663382975 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40