bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2793_orf1 Length=211 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_3000 92.8 6e-18 > 5807.cgd7_3000 Length=218 Score = 92.8 bits (229), Expect = 6e-18, Method: Compositional matrix adjust. Identities = 60/163 (36%), Positives = 84/163 (51%), Gaps = 23/163 (14%) Query 13 KETLVNLIATLNQCFPDYEFSSTLTPPMFREEESVAEAQGDINEKLRA-VEQLLPGFINE 71 +E LVNLI+T+NQCFPDYEF S + P +E+S + +IN L + VE++ P F+ E Sbjct 74 RELLVNLISTMNQCFPDYEF-SLIKPDNLFKEKSFSIVYNNINYHLSSIVERIYPSFLLE 132 Query 72 LWTAIESAVCLSSCAVYSHSAAGSGEASALGCLWSCLLPPSAAAAAAAAADGGFCLSSFA 131 LW I AV + +YS+ G+ E S DG L SF Sbjct 133 LWENIRDAVEIKYTEIYSYRLMGNDELSPF------------------LDDGS--LFSFD 172 Query 132 YFFVEKQRDRVLFFACCSSSKLSSPSWLGALDSCQLHDQDDSE 174 YFF + + ++LFFAC + SKL+ LDS + DD+E Sbjct 173 YFFYDTKSQKILFFACTTKSKLNIGFTDNGLDSSE-ESIDDNE 214 Lambda K H 0.317 0.130 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53680939224 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40