bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2753_orf2 Length=178 Score E Sequences producing significant alignments: (Bits) Value 7227.CG1746-PB 63.2 3e-09 > 7227.CG1746-PB Length=138 Score = 63.2 bits (152), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 44/122 (36%), Positives = 67/122 (54%), Gaps = 11/122 (9%) Query 58 RALSTAPLLQRHSAVAQGPCARWPAAALTPLSSSSSSSSGGSPVGAVRHEASVAT-LSAA 116 R LS+A + Q + AQ P A L + S +S PV R S A + A Sbjct 26 RPLSSAIISQSQTLAAQNTT---PVALLPQIRSFQTS-----PV--TRDIDSAAKFIGAG 75 Query 117 VALMSVGGVAQGIGSLFAALVSGTARNPSIKEDLFTYTLIGMGFLEFLGIICVMMSAVLL 176 A + V G GIG++F +L+ G ARNPS+K+ LF+Y ++G E +G+ C+MM+ +LL Sbjct 76 AATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMMAFLLL 135 Query 177 YS 178 ++ Sbjct 136 FA 137 Lambda K H 0.321 0.130 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40